| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50088909 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_226355 |
|---|
| IC50 | 30000±n/a nM |
|---|
| Citation |  Missbach, M; Altmann, E; Widler, L; Susa, M; Buchdunger, E; Mett, H; Meyer, T; Green, J Substituted 5,7-diphenyl-pyrrolo[2,3d]pyrimidines: potent inhibitors of the tyrosine kinase c-Src. Bioorg Med Chem Lett10:945-9 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50088909 |
|---|
| n/a |
|---|
| Name | BDBM50088909 |
|---|
| Synonyms: | (4-(4-amino-5-phenyl-7H-pyrrolo[2,3-d]pyrimidin-7-yl)phenyl)methanol | CHEMBL367442 | [4-(4-Amino-5-phenyl-pyrrolo[2,3-d]pyrimidin-7-yl)-phenyl]-methanol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16N4O |
|---|
| Mol. Mass. | 316.3565 |
|---|
| SMILES | Nc1ncnc2n(cc(-c3ccccc3)c12)-c1ccc(CO)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
