| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocyte-stimulating hormone receptor |
|---|
| Ligand | BDBM50574238 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2122093 (CHEMBL4831240) |
|---|
| EC50 | 7.0±n/a nM |
|---|
| Citation |  Ericson, MD; Doering, SR; Larson, CM; Freeman, KT; LaVoi, TM; Donow, HM; Santos, RG; Cho, RH; Koerperich, ZM; Giulianotti, MA; Pinilla, C; Houghten, RA; Haskell-Luevano, C Functional Mixture-Based Positional Scan Identifies a Library of Antagonist Tetrapeptide Sequences (LAtTeS) with Nanomolar Potency for the Melanocortin-4 Receptor and Equipotent with the Endogenous AGRP(86-132) Antagonist. J Med Chem64:14860-14875 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocyte-stimulating hormone receptor |
|---|
| Name: | Melanocyte-stimulating hormone receptor |
|---|
| Synonyms: | MC1-R | MSHR_MOUSE | Mc1r | Melanocortin receptor 1 | Melanocyte-stimulating hormone receptor | Msh-r |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35238.60 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_1498846 |
|---|
| Residue: | 315 |
|---|
| Sequence: | MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIA
ITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDV
LICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITY
YKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAAT
LTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRS
QELRMTLKEVLLCSW
|
|
|
|---|
| BDBM50574238 |
|---|
| n/a |
|---|
| Name | BDBM50574238 |
|---|
| Synonyms: | CHEMBL4848870 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H45I2N11O5 |
|---|
| Mol. Mass. | 917.5793 |
|---|
| SMILES | CC(=O)N[C@H](Cc1ccc(I)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](Cc1ccc(I)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
