Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Melanocyte-stimulating hormone receptor |
---|
Ligand | BDBM50574238 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2122093 (CHEMBL4831240) |
---|
EC50 | 7.0±n/a nM |
---|
Citation | Ericson, MD; Doering, SR; Larson, CM; Freeman, KT; LaVoi, TM; Donow, HM; Santos, RG; Cho, RH; Koerperich, ZM; Giulianotti, MA; Pinilla, C; Houghten, RA; Haskell-Luevano, C Functional Mixture-Based Positional Scan Identifies a Library of Antagonist Tetrapeptide Sequences (LAtTeS) with Nanomolar Potency for the Melanocortin-4 Receptor and Equipotent with the Endogenous AGRP(86-132) Antagonist. J Med Chem64:14860-14875 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanocyte-stimulating hormone receptor |
---|
Name: | Melanocyte-stimulating hormone receptor |
Synonyms: | MC1-R | MSHR_MOUSE | Mc1r | Melanocortin receptor 1 | Melanocyte-stimulating hormone receptor | Msh-r |
Type: | PROTEIN |
Mol. Mass.: | 35238.60 |
Organism: | Mus musculus |
Description: | ChEMBL_1498846 |
Residue: | 315 |
Sequence: | MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIA
ITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDV
LICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITY
YKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAAT
LTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRS
QELRMTLKEVLLCSW
|
|
|
BDBM50574238 |
---|
n/a |
---|
Name | BDBM50574238 |
Synonyms: | CHEMBL4848870 |
Type | Small organic molecule |
Emp. Form. | C32H45I2N11O5 |
Mol. Mass. | 917.5793 |
SMILES | CC(=O)N[C@H](Cc1ccc(I)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](Cc1ccc(I)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O |r| |
Structure |
|