Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Programmed cell death 1 ligand/protein 1 |
---|
Ligand | BDBM50582859 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2156092 (CHEMBL5040752) |
---|
IC50 | 92±n/a nM |
---|
Citation | Russomanno, P; Assoni, G; Amato, J; D'Amore, VM; Scaglia, R; Brancaccio, D; Pedrini, M; Polcaro, G; La Pietra, V; Orlando, P; Falzoni, M; Cerofolini, L; Giuntini, S; Fragai, M; Pagano, B; Donati, G; Novellino, E; Quintavalle, C; Condorelli, G; Sabbatino, F; Seneci, P; Arosio, D; Pepe, S; Marinelli, L Interfering with the Tumor-Immune Interface: Making Way for Triazine-Based Small Molecules as Novel PD-L1 Inhibitors. J Med Chem64:16020-16045 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Programmed cell death 1 ligand/protein 1 |
---|
Name: | Programmed cell death 1 ligand/protein 1 |
Synonyms: | PD-1/PD-L1 | Programmed cell death protein 1/Programmed cell death 1 ligand 1 |
Type: | Protein |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Programmed cell death protein 1 |
Synonyms: | CD_antigen=CD279 | PD1 | PDCD1 | PDCD1_HUMAN | Programmed cell death protein 1 | Protein PD-1 | hPD-1 |
Type: | PROTEIN |
Mol. Mass.: | 31650.07 |
Organism: | Homo sapiens |
Description: | ChEMBL_108437 |
Residue: | 288 |
Sequence: | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
|
|
|
Component 2 |
Name: | Programmed cell death 1 ligand 1 |
Synonyms: | B7 homolog 1 | B7-H1 | B7H1 | B7H1 | CD274 | CD_antigen=CD274 | PD-L1 | PD1L1_HUMAN | PDCD1 ligand 1 | PDCD1L1 | PDCD1LG1 | PDL1 | Programmed cell death 1 ligand 1 | Programmed death ligand 1 |
Type: | PROTEIN |
Mol. Mass.: | 33278.49 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_109807 |
Residue: | 290 |
Sequence: | MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
|
|
|
BDBM50582859 |
---|
n/a |
---|
Name | BDBM50582859 |
Synonyms: | CHEMBL5072370 |
Type | Small organic molecule |
Emp. Form. | C25H26N4O4 |
Mol. Mass. | 446.4983 |
SMILES | Cc1c(COc2ccc(CNCCO)n3cnnc23)cccc1-c1ccc2OCCOc2c1 |
Structure |
|