Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Melanocyte-stimulating hormone receptor |
---|
Ligand | BDBM50152806 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_303687 (CHEMBL829732) |
---|
Ki | 27±n/a nM |
---|
Citation | Pontillo, J; Tran, JA; Arellano, M; Fleck, BA; Huntley, R; Marinkovic, D; Lanier, M; Nelson, J; Parker, J; Saunders, J; Tucci, FC; Jiang, W; Chen, CW; White, NS; Foster, AC; Chen, C Structure-activity relationships of piperazinebenzylamines as potent and selective agonists of the human melanocortin-4 receptor. Bioorg Med Chem Lett14:4417-23 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanocyte-stimulating hormone receptor |
---|
Name: | Melanocyte-stimulating hormone receptor |
Synonyms: | MC1-R | MC1R | MSH-R | MSHR | MSHR_HUMAN | Melanocortin MC1 | Melanocortin receptor (M1 and M4) | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R) |
Type: | Enzyme |
Mol. Mass.: | 34717.23 |
Organism: | Homo sapiens (Human) |
Description: | Q01726 |
Residue: | 317 |
Sequence: | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
|
|
|
BDBM50152806 |
---|
n/a |
---|
Name | BDBM50152806 |
Synonyms: | (R)-N-((R)-1-(4-(2-(aminomethyl)phenyl)piperazin-1-yl)-3-(4-chlorophenyl)-1-oxopropan-2-yl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide | 1,2,3,4-Tetrahydro-isoquinoline-3-carboxylic acid [(R)-2-[4-(2-aminomethyl-phenyl)-piperazin-1-yl]-1-(4-chloro-benzyl)-2-oxo-ethyl]-amide | CHEMBL183434 |
Type | Small organic molecule |
Emp. Form. | C30H34ClN5O2 |
Mol. Mass. | 532.076 |
SMILES | NCc1ccccc1N1CCN(CC1)C(=O)[C@@H](Cc1ccc(Cl)cc1)NC(=O)[C@H]1Cc2ccccc2CN1 |r| |
Structure |
|