| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein S100-B |
|---|
| Ligand | BDBM50154226 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_302128 (CHEMBL841752) |
|---|
| Kd | 120000±n/a nM |
|---|
| Citation |  Markowitz, J; Chen, I; Gitti, R; Baldisseri, DM; Pan, Y; Udan, R; Carrier, F; MacKerell, AD; Weber, DJ Identification and characterization of small molecule inhibitors of the calcium-dependent S100B-p53 tumor suppressor interaction. J Med Chem47:5085-93 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein S100-B |
|---|
| Name: | Protein S100-B |
|---|
| Synonyms: | S-100 protein beta chain | S100B | S100B_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10701.34 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_947124 |
|---|
| Residue: | 92 |
|---|
| Sequence: | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
|
|
|
|---|
| BDBM50154226 |
|---|
| n/a |
|---|
| Name | BDBM50154226 |
|---|
| Synonyms: | 5-{[1,3-Dioxo-2-(2,4,6-trimethyl-phenyl)-2,3-dihydro-1H-isoindole-5-carbonyl]-amino}-isophthalic acid | CHEMBL187059 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H20N2O7 |
|---|
| Mol. Mass. | 472.4462 |
|---|
| SMILES | Cc1cc(C)c(N2C(=O)c3ccc(cc3C2=O)C(=O)Nc2cc(cc(c2)C(O)=O)C(O)=O)c(C)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
