| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RNA-directed RNA polymerase |
|---|
| Ligand | BDBM50182778 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_351511 (CHEMBL870070) |
|---|
| IC50 | 8100±n/a nM |
|---|
| Citation |  Gopalsamy, A; Shi, M; Ciszewski, G; Park, K; Ellingboe, JW; Orlowski, M; Feld, B; Howe, AY Design and synthesis of 2,3,4,9-tetrahydro-1H-carbazole and 1,2,3,4-tetrahydro-cyclopenta[b]indole derivatives as non-nucleoside inhibitors of hepatitis C virus NS5B RNA-dependent RNA polymerase. Bioorg Med Chem Lett16:2532-4 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RNA-directed RNA polymerase |
|---|
| Name: | RNA-directed RNA polymerase |
|---|
| Synonyms: | Hepatitis C virus NS5B RNA-dependent RNA polymerase | NS5B protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25173.95 |
|---|
| Organism: | Hepatitis C virus |
|---|
| Description: | Q8JXU8 |
|---|
| Residue: | 229 |
|---|
| Sequence: | RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
|
|
|
|---|
| BDBM50182778 |
|---|
| n/a |
|---|
| Name | BDBM50182778 |
|---|
| Synonyms: | 8-cyano-5-fluoro-3-propyl-1,2,3,4-tetrahydrocyclopenta[b]indole-3-carboxylic acid | CHEMBL207299 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H15FN2O2 |
|---|
| Mol. Mass. | 286.3009 |
|---|
| SMILES | CCCC1(CCc2c1[nH]c1c(F)ccc(C#N)c21)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
