Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM370258 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2276758 |
---|
EC50 | 4000±n/a nM |
---|
Citation | Freeman-Cook, KD; Hoffman, RL; Behenna, DC; Boras, B; Carelli, J; Diehl, W; Ferre, RA; He, YA; Hui, A; Huang, B; Huser, N; Jones, R; Kephart, SE; Lapek, J; McTigue, M; Miller, N; Murray, BW; Nagata, A; Nguyen, L; Niessen, S; Ninkovic, S; O'Doherty, I; Ornelas, MA; Solowiej, J; Sutton, SC; Tran, K; Tseng, E; Visswanathan, R; Xu, M; Zehnder, L; Zhang, Q; Zhang, C; Dann, S Discovery of PF-06873600, a CDK2/4/6 Inhibitor for the Treatment of Cancer. J Med Chem64:9056-9077 (2021) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM370258 |
---|
n/a |
---|
Name | BDBM370258 |
Synonyms: | BDBM467153 | US10233188, Example 145 |
Type | Small organic molecule |
Emp. Form. | C20H29N5O4S |
Mol. Mass. | 435.54 |
SMILES | CS(=O)(=O)N1CCC(CC1)Nc1ncc2cc(CCO)c(=O)n(C3CCCC3)c2n1 |
Structure |
|