| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50267866 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_563014 (CHEMBL1016198) |
|---|
| IC50 | 22300±n/a nM |
|---|
| Citation |  Tsou, HR; Liu, X; Birnberg, G; Kaplan, J; Otteng, M; Tran, T; Kutterer, K; Tang, Z; Suayan, R; Zask, A; Ravi, M; Bretz, A; Grillo, M; McGinnis, JP; Rabindran, SK; Ayral-Kaloustian, S; Mansour, TS Discovery of 4-(benzylaminomethylene)isoquinoline-1,3-(2H,4H)-diones and 4-[(pyridylmethyl)aminomethylene]isoquinoline-1,3-(2H,4H)-diones as potent and selective inhibitors of the cyclin-dependent kinase 4. J Med Chem52:2289-310 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50267866 |
|---|
| n/a |
|---|
| Name | BDBM50267866 |
|---|
| Synonyms: | 4-[(3-Hydroxy-4-methoxy-benzylamino)-methylene]-6-methoxy-4H-isoquinoline-1,3-dione | CHEMBL489246 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H18N2O5 |
|---|
| Mol. Mass. | 354.3566 |
|---|
| SMILES | COc1ccc2C(=O)NC(=O)C(=CNCc3ccc(OC)c(O)c3)c2c1 |w:12.12| |
|---|
| Structure | 
|
|---|
Search and Browse
