| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 4/G1/S-specific cyclin-D1 |
|---|
| Ligand | BDBM41575 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_631412 (CHEMBL1111117) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Beria, I; Ballinari, D; Bertrand, JA; Borghi, D; Bossi, RT; Brasca, MG; Cappella, P; Caruso, M; Ceccarelli, W; Ciavolella, A; Cristiani, C; Croci, V; De Ponti, A; Fachin, G; Ferguson, RD; Lansen, J; Moll, JK; Pesenti, E; Posteri, H; Perego, R; Rocchetti, M; Storici, P; Volpi, D; Valsasina, B Identification of 4,5-dihydro-1H-pyrazolo[4,3-h]quinazoline derivatives as a new class of orally and selective Polo-like kinase 1 inhibitors. J Med Chem53:3532-51 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 4/G1/S-specific cyclin-D1 |
|---|
| Name: | Cyclin-dependent kinase 4/G1/S-specific cyclin-D1 |
|---|
| Synonyms: | CDK4/CycD | CDK4/CycD1 | CDK4/Cyclin D1 | CDK4/D1 | Cyclin-Dependent Kinase 4 (CDK4) | Cyclin-dependent kinase 4 | Cyclin-dependent kinase 4/G1/S-specific cyclin D1 | Cyclin-dependent kinase 4/cyclin D1 |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | CDK4/D1 complexes were purified from insect cells co-infected with baculovirus vectors containing each of the components. |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Cyclin-dependent kinase 4 |
|---|
| Synonyms: | CDK4 | CDK4_HUMAN | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3 |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 33731.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11802 |
|---|
| Residue: | 303 |
|---|
| Sequence: | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
|
|
|
|---|
| Component 2 |
| Name: | G1/S-specific cyclin-D1 |
|---|
| Synonyms: | B-cell lymphoma 1 protein | BCL-1 | BCL-1 oncogene | BCL1 | CCND1 | CCND1_HUMAN | PRAD1 | PRAD1 oncogene |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 33717.70 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 295 |
|---|
| Sequence: | MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
|
|
|
|---|
| BDBM41575 |
|---|
| n/a |
|---|
| Name | BDBM41575 |
|---|
| Synonyms: | CHEMBL1094408 | US8614220, A85B1C1Z |
|---|
| Type | n/a |
|---|
| Emp. Form. | C23H28N8O2 |
|---|
| Mol. Mass. | 448.5208 |
|---|
| SMILES | COc1ccc(cc1Nc1ncc2CCc3c(nn(C)c3-c2n1)C(N)=O)N1CCN(C)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
