| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1D |
|---|
| Ligand | BDBM50145350 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1712 |
|---|
| Ki | 51±n/a nM |
|---|
| Citation |  Timms, GH; Boot, JR; Broadmore, RJ; Carney, SL; Cooper, J; Findlay, JD; Gilmore, J; Mitchell, S; Moore, NA; Pullar, I; Sanger, GJ; Tomlinson, R; Tree, BB; Wedley, S SAR development of a selective 5-HT1D antagonist/serotonin reuptake inhibitor lead using rapid parallel synthesis. Bioorg Med Chem Lett14:2469-72 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1D |
|---|
| Name: | 5-hydroxytryptamine receptor 1D |
|---|
| Synonyms: | 5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | 5HT1D_HUMAN | HTR1D | HTR1DA | HTRL | Serotonin (5-HT) receptor | Serotonin Receptor 1D |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41920.63 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells. |
|---|
| Residue: | 377 |
|---|
| Sequence: | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
|
|
|
|---|
| BDBM50145350 |
|---|
| n/a |
|---|
| Name | BDBM50145350 |
|---|
| Synonyms: | 1-{2-[4-(6-Fluoro-1-methyl-1H-indazol-3-yl)-3,6-dihydro-2H-pyridin-1-yl]-ethyl}-isochroman-6-carboxylic acid amide | CHEMBL442974 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H27FN4O2 |
|---|
| Mol. Mass. | 434.5059 |
|---|
| SMILES | Cn1nc(C2=CCN(CCC3OCCc4cc(ccc34)C(N)=O)CC2)c2ccc(F)cc12 |t:4| |
|---|
| Structure | 
|
|---|
Search and Browse
