Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50453048 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_147104 (CHEMBL882760) |
---|
IC50 | 48300±n/a nM |
---|
Citation | Hruby, VJ; Toth, G; Gehrig, CA; Kao, LF; Knapp, R; Lui, GK; Yamamura, HI; Kramer, TH; Davis, P; Burks, TF Topographically designed analogues of [D-Pen,D-Pen5]enkephalin. J Med Chem34:1823-30 (1991) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50453048 |
---|
n/a |
---|
Name | BDBM50453048 |
Synonyms: | CHEMBL2115042 |
Type | Small organic molecule |
Emp. Form. | C31H41N5O7S2 |
Mol. Mass. | 659.817 |
SMILES | [H][C@@]1(NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(C)(C)SSC(C)(C)[C@H](NC1=O)C(O)=O)[C@H](C)c1ccccc1 |
Structure |
|