Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Farnesyl pyrophosphate synthase |
---|
Ligand | BDBM12578 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_466619 (CHEMBL924793) |
---|
Ki | 85.9±n/a nM |
---|
Citation | Dunford, JE; Kwaasi, AA; Rogers, MJ; Barnett, BL; Ebetino, FH; Russell, RG; Oppermann, U; Kavanagh, KL Structure-activity relationships among the nitrogen containing bisphosphonates in clinical use and other analogues: time-dependent inhibition of human farnesyl pyrophosphate synthase. J Med Chem51:2187-95 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Farnesyl pyrophosphate synthase |
---|
Name: | Farnesyl pyrophosphate synthase |
Synonyms: | Dimethylallyltranstransferase | FDPS | FPP synthase | FPP synthetase | FPPS_HUMAN | FPS | Farnesyl diphosphate synthase | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | KIAA1293 | P14324 |
Type: | Enzyme |
Mol. Mass.: | 48272.89 |
Organism: | Homo sapiens (Human) |
Description: | P14324 |
Residue: | 419 |
Sequence: | MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
|
|
|
BDBM12578 |
---|
n/a |
---|
Name | BDBM12578 |
Synonyms: | 2-(imidazol-1-yl)-1-hydroxyethylidene-1,1-bisphosphonic acid | Bisphosphonate 3 | CGP-42446 | CHEMBL924 | JMC515594 Compound 55 | Reclast | US11279719, Example Zolendronic acid (ZOL) | ZOL | Zoledronate | Zometa | [1-hydroxy-2-(1H-imidazol-1-yl)-1-phosphonoethyl]phosphonic acid | zoledronic acid |
Type | Small organic molecule |
Emp. Form. | C5H10N2O7P2 |
Mol. Mass. | 272.0896 |
SMILES | OC(Cn1ccnc1)(P(O)(O)=O)P(O)(O)=O |
Structure |
|