Reaction Details |
| Report a problem with these data |
Target | Galectin-1 |
---|
Ligand | BDBM50272262 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_510247 (CHEMBL1005625) |
---|
IC50 | >5000000±n/a nM |
---|
Citation | Giguère, D; Bonin, MA; Cloutier, P; Patnam, R; St-Pierre, C; Sato, S; Roy, R Synthesis of stable and selective inhibitors of human galectins-1 and -3. Bioorg Med Chem16:7811-23 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Galectin-1 |
---|
Name: | Galectin-1 |
Synonyms: | 14 kDa lectin | Galaptin | HPL | LEG1_HUMAN | LGALS1 | Lactose-binding lectin 1 | Lectin galactoside-binding soluble 1 | Putative MAPK-activating protein PM12 |
Type: | beta galactoside-binding protein |
Mol. Mass.: | 14713.53 |
Organism: | Homo sapiens (Human) |
Description: | P09382 |
Residue: | 135 |
Sequence: | MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
|
|
|
BDBM50272262 |
---|
n/a |
---|
Name | BDBM50272262 |
Synonyms: | 5-(beta-D-Galactopyranosyl)-4-methyl-2-(2-chloro-phenyl)sulfonylaminothiazole | CHEMBL502549 |
Type | Small organic molecule |
Emp. Form. | C17H21ClN2O7S2 |
Mol. Mass. | 464.941 |
SMILES | Cc1nc(NS(=O)(=O)c2ccccc2Cl)sc1C[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O |r| |
Structure |
|