| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50386162 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_824647 (CHEMBL2045705) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Chini, MG; De Simone, R; Bruno, I; Riccio, R; Dehm, F; Weinigel, C; Barz, D; Werz, O; Bifulco, G Design and synthesis of a second series of triazole-based compounds as potent dual mPGES-1 and 5-lipoxygenase inhibitors. Eur J Med Chem54:311-23 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50386162 |
|---|
| n/a |
|---|
| Name | BDBM50386162 |
|---|
| Synonyms: | CHEMBL2042363 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H16N4O5 |
|---|
| Mol. Mass. | 416.3862 |
|---|
| SMILES | OC(=O)c1ccc(Cn2cc(nn2)-c2ccc(cc2)-c2ccc(O)cc2)c(c1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
