| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 1 |
|---|
| Ligand | BDBM50420174 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_834831 (CHEMBL2073148) |
|---|
| EC50 | 31623±n/a nM |
|---|
| Citation |  Sanders, MP; Roumen, L; van der Horst, E; Lane, JR; Vischer, HF; van Offenbeek, J; de Vries, H; Verhoeven, S; Chow, KY; Verkaar, F; Beukers, MW; McGuire, R; Leurs, R; Ijzerman, AP; de Vlieg, J; de Esch, IJ; Zaman, GJ; Klomp, JP; Bender, A; de Graaf, C A prospective cross-screening study on G-protein-coupled receptors: lessons learned in virtual compound library design. J Med Chem55:5311-25 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 1 |
|---|
| Name: | Sphingosine 1-phosphate receptor 1 |
|---|
| Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 42836.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21453 |
|---|
| Residue: | 382 |
|---|
| Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
|---|
| BDBM50420174 |
|---|
| n/a |
|---|
| Name | BDBM50420174 |
|---|
| Synonyms: | CHEMBL2070837 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H22BrF3N2O4S |
|---|
| Mol. Mass. | 547.385 |
|---|
| SMILES | CC(=O)N1CCc2cc(Br)cc(c12)S(=O)(=O)N1CCC(O)(CC1)c1cccc(c1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
