Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Apoptosis regulator Bcl-2 |
---|
Ligand | BDBM50397473 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_862012 (CHEMBL2173962) |
---|
IC50 | 1908±n/a nM |
---|
Citation | Chen, J; Zhou, H; Aguilar, A; Liu, L; Bai, L; McEachern, D; Yang, CY; Meagher, JL; Stuckey, JA; Wang, S Structure-based discovery of BM-957 as a potent small-molecule inhibitor of Bcl-2 and Bcl-xL capable of achieving complete tumor regression. J Med Chem55:8502-14 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 |
---|
Name: | Apoptosis regulator Bcl-2 |
Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
Type: | Homodimer or heterodimer |
Mol. Mass.: | 26269.11 |
Organism: | Homo sapiens (Human) |
Description: | P10415 |
Residue: | 239 |
Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
BDBM50397473 |
---|
n/a |
---|
Name | BDBM50397473 |
Synonyms: | CHEMBL2171009 |
Type | Small organic molecule |
Emp. Form. | C47H58ClN7O3S |
Mol. Mass. | 836.527 |
SMILES | CN1CCN(CCCNC(=O)c2c(C)n(C)c(c2-c2cccc(c2)N2CCN(CC2)c2ccc(NS(=O)(=O)c3cccc(c3)C(C)(C)C)cc2)-c2ccc(Cl)cc2)CC1 |
Structure |
|