| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fibroblast growth factor 2 |
|---|
| Ligand | BDBM50421317 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_840111 (CHEMBL2090814) |
|---|
| Kd | 240000±n/a nM |
|---|
| Citation |  Liu, L; Li, C; Cochran, S; Feder, D; Guddat, LW; Ferro, V A focused sulfated glycoconjugate Ugi library for probing heparan sulfate-binding angiogenic growth factors. Bioorg Med Chem Lett22:6190-4 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fibroblast growth factor 2 |
|---|
| Name: | Fibroblast growth factor 2 |
|---|
| Synonyms: | Basic fibroblast growth factor | FGF-2 | FGF2 | FGF2_HUMAN | FGFB | Fibroblast growth factor 2 (bFGF) | Fibroblast growth factor receptor 2 (FGF-2) | HBGF-2 | Heparin-binding growth factor 2 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30803.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P09038 |
|---|
| Residue: | 288 |
|---|
| Sequence: | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
|
|
|
|---|
| BDBM50421317 |
|---|
| n/a |
|---|
| Name | BDBM50421317 |
|---|
| Synonyms: | CHEMBL2087904 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22N2O20S4 |
|---|
| Mol. Mass. | 714.631 |
|---|
| SMILES | CC(=O)N(CC(=O)NCCO[C@H]1O[C@H](COS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@H](OS([O-])(=O)=O)[C@@H]1OS([O-])(=O)=O)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
