| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tumor necrosis factor ligand superfamily member 11 |
|---|
| Ligand | BDBM50128342 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1523723 (CHEMBL3631862) |
|---|
| IC50 | 1310±n/a nM |
|---|
| Citation |  Kang, JH; Ting, Z; Moon, MR; Sim, JS; Lee, JM; Doh, KE; Hong, S; Cui, M; Choi, S; Chang, HW; Park Choo, HY; Yim, M 5-Lipoxygenase inhibitors suppress RANKL-induced osteoclast formation via NFATc1 expression. Bioorg Med Chem23:7069-78 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tumor necrosis factor ligand superfamily member 11 |
|---|
| Name: | Tumor necrosis factor ligand superfamily member 11 |
|---|
| Synonyms: | CD_antigen=CD254 | ODF | Opgl | Osteoclast differentiation factor | Osteoprotegerin ligand | Rankl | Receptor activator of nuclear factor kappa-B ligand | TNF-related activation-induced cytokine | TNF11_MOUSE | Tnfsf11 | Trance | Tumor necrosis factor ligand superfamily member 11, membrane form | Tumor necrosis factor ligand superfamily member 11, soluble form |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35008.20 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_109846 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQ
VVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQ
AFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHK
VTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVY
VVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDP
DQDATYFGAFKVQDID
|
|
|
|---|
| BDBM50128342 |
|---|
| n/a |
|---|
| Name | BDBM50128342 |
|---|
| Synonyms: | CHEMBL3629175 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H29N5O4 |
|---|
| Mol. Mass. | 487.5503 |
|---|
| SMILES | CCc1ccc(Nc2nc3cc(NC(=O)CCCCOc4ccc(cc4)C(\N)=N\O)ccc3o2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
