Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | D(3) dopamine receptor |
---|
Ligand | BDBM50192242 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1613477 (CHEMBL3855277) |
---|
Ki | 1.4±n/a nM |
---|
Citation | Micheli, F; Bacchi, A; Braggio, S; Castelletti, L; Cavallini, P; Cavanni, P; Cremonesi, S; Dal Cin, M; Feriani, A; Gehanne, S; Kajbaf, M; Marchió, L; Nola, S; Oliosi, B; Pellacani, A; Perdoną, E; Sava, A; Semeraro, T; Tarsi, L; Tomelleri, S; Wong, A; Visentini, F; Zonzini, L; Heidbreder, C 1,2,4-Triazolyl 5-Azaspiro[2.4]heptanes: Lead Identification and Early Lead Optimization of a New Series of Potent and Selective Dopamine D3 Receptor Antagonists. J Med Chem59:8549-76 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
D(3) dopamine receptor |
---|
Name: | D(3) dopamine receptor |
Synonyms: | DOPAMINE D3 | DRD3 | DRD3_HUMAN | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3 |
Type: | n/a |
Mol. Mass.: | 44243.43 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 400 |
Sequence: | MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
|
|
|
BDBM50192242 |
---|
n/a |
---|
Name | BDBM50192242 |
Synonyms: | CHEMBL3922535 | US10239870, Example 177 |
Type | Small organic molecule |
Emp. Form. | C25H25F3N6S |
Mol. Mass. | 498.566 |
SMILES | Cn1c(SCCCN2CC[C@]3(C[C@@H]3c3ccc(cc3)C(F)(F)F)C2)nnc1-c1ccc(nc1)C#N |r| |
Structure |
|