Reaction Details |
| Report a problem with these data |
Target | Outer membrane protein MIP |
---|
Ligand | BDBM50200293 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1622004 (CHEMBL3864356) |
---|
IC50 | 10715±n/a nM |
---|
Citation | Seufert, F; Kuhn, M; Hein, M; Weiwad, M; Vivoli, M; Norville, IH; Sarkar-Tyson, M; Marshall, LE; Schweimer, K; Bruhn, H; Rösch, P; Harmer, NJ; Sotriffer, CA; Holzgrabe, U Development, synthesis and structure-activity-relationships of inhibitors of the macrophage infectivity potentiator (Mip) proteins of Legionella pneumophila and Burkholderia pseudomallei. Bioorg Med Chem24:5134-5147 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Outer membrane protein MIP |
---|
Name: | Outer membrane protein MIP |
Synonyms: | MIP_LEGPN | Macrophage infectivity potentiator | PPIase | Peptidyl-prolyl cis-trans isomerase | Rotamase | mip |
Type: | PROTEIN |
Mol. Mass.: | 24869.94 |
Organism: | Legionella pneumophila |
Description: | ChEMBL_701873 |
Residue: | 233 |
Sequence: | MKMKLVTAAVMGLAMSTAMAATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAK
GMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPG
VVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIP
GWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
|
|
|
BDBM50200293 |
---|
n/a |
---|
Name | BDBM50200293 |
Synonyms: | CHEMBL3896009 |
Type | Small organic molecule |
Emp. Form. | C21H26N2O4S |
Mol. Mass. | 402.507 |
SMILES | O=C(OCCCc1cccnc1)C1CCCCN1S(=O)(=O)Cc1ccccc1 |
Structure |
|