Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Matrilysin |
---|
Ligand | BDBM92443 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Enzyme Assay |
---|
pH | 6.8±0 |
---|
Temperature | 298.15±0 K |
---|
Ki | 2010±0.0 nM |
---|
Citation | Devel, L; Garcia, S; Czarny, B; Beau, F; LaJeunesse, E; Vera, L; Georgiadis, D; Stura, E; Dive, V Insights from selective non-phosphinic inhibitors of MMP-12 tailored to fit with an S1' loop canonical conformation. J Biol Chem285:35900-9 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Matrilysin |
---|
Name: | Matrilysin |
Synonyms: | MMP7 | MMP7_HUMAN | MPSL1 | Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7) | Matrix metalloproteinase-7 (MMP7) | PUMP1 |
Type: | Enzyme |
Mol. Mass.: | 29681.54 |
Organism: | Homo sapiens (Human) |
Description: | P09237 |
Residue: | 267 |
Sequence: | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
|
|
|
BDBM92443 |
---|
n/a |
---|
Name | BDBM92443 |
Synonyms: | MMP Inhibitor, 3 | Thiophene derivative, compound 36 | US8691753, 97 |
Type | Small molecule |
Emp. Form. | C29H31N3O7S |
Mol. Mass. | 565.637 |
SMILES | NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CCc1ccc(cc1)-c1cc(cs1)-c1ccccc1 |r| |
Structure |
|