Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM148237 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | IMAP-FPT (Molecular Devices Trade Mark Technology) Endpoint Assay |
---|
Temperature | 298.15±n/a K |
---|
IC50 | >15000±n/a nM |
---|
Comments | extracted |
---|
Citation | Brain, CT; Sung, MJ; Lagu, B Pyrrolopyrimidine compounds and their uses US Patent US8962630 Publication Date 2/24/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM148237 |
---|
n/a |
---|
Name | BDBM148237 |
Synonyms: | US8962630, 46 |
Type | Small organic molecule |
Emp. Form. | C26H36N8O3 |
Mol. Mass. | 508.6158 |
SMILES | CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCN(C[C@@H](O)CO)CC3)nc2n1C1CCCC1 |r| |
Structure |
|