| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Short-chain Z-isoprenyl diphosphate synthase |
|---|
| Ligand | BDBM153369 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Radiometric Assay |
|---|
| IC50 | 4e+2±n/a nM |
|---|
| Citation |  Kim, MO; Feng, X; Feixas, F; Zhu, W; Lindert, S; Bogue, S; Sinko, W; de Oliveira, C; Rao, G; Oldfield, E; McCammon, JA A Molecular Dynamics Investigation of Mycobacterium tuberculosis Prenyl Synthases: Conformational Flexibility and Implications for Computer-aided Drug Discovery. Chem Biol Drug Des85:756-69 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Short-chain Z-isoprenyl diphosphate synthase |
|---|
| Name: | Short-chain Z-isoprenyl diphosphate synthase |
|---|
| Synonyms: | ZFPP_MYCBO | cis-Farnesyl diphosphate synthase (cis-FPPS) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29475.52 |
|---|
| Organism: | Mycobacterium tuberculosis H37Rv |
|---|
| Description: | Q7U0P8 |
|---|
| Residue: | 262 |
|---|
| Sequence: | MEIIPPRLKEPLYRLYELRLRQGLAASKSDLPRHIAVLCDGNRRWARSAGYDDVSYGYRM
GAAKIAEMLRWCHEAGIELATVYLLSTENLQRDPDELAALIEIITDVVEEICAPANHWSV
RTVGDLGLIGEEPARRLRGAVESTPEVASFHVNVAVGYGGRREIVDAVRALLSKELANGA
TAEELVDAVTVEGISENLYTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTEAHWPA
FRHVDFLRALRDYSARHRRYGR
|
|
|
|---|
| BDBM153369 |
|---|
| n/a |
|---|
| Name | BDBM153369 |
|---|
| Synonyms: | BPH-1425 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H42N4O12 |
|---|
| Mol. Mass. | 746.7597 |
|---|
| SMILES | N[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1Oc1cccc(NC(=O)c2ccc(cc2)-c2ccc(cc2)C(=O)Nc2cccc(O[C@@H]3O[C@H](CO)[C@@H](O)[C@H](O)[C@H]3N)c2)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
