Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | E3 ubiquitin-protein ligase Mdm2 [1-118,T47W] |
---|
Ligand | BDBM207981 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Microscale Thermophoresis (MT) Binding Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 298.15±n/a K |
---|
Kd | 3.04e+4± 2e+2 nM |
---|
Comments | extracted |
---|
Citation | Surmiak, E; Twarda-Clapa, A; Zak, KM; Musielak, B; Tomala, MD; Kubica, K; Grudnik, P; Madej, M; Jablonski, M; Potempa, J; Kalinowska-Tluscik, J; Dömling, A; Dubin, G; Holak, TA A Unique Mdm2-Binding Mode of the 3-Pyrrolin-2-one- and 2-Furanone-Based Antagonists of the p53-Mdm2 Interaction. ACS Chem Biol11:3310-3318 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
E3 ubiquitin-protein ligase Mdm2 [1-118,T47W] |
---|
Name: | E3 ubiquitin-protein ligase Mdm2 [1-118,T47W] |
Synonyms: | MDM2 | MDM2_HUMAN |
Type: | Protein |
Mol. Mass.: | 13556.52 |
Organism: | Homo sapiens (Human) |
Description: | Mdm2 truncation (1-118 aa) with mutation at T47W |
Residue: | 118 |
Sequence: | MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDWYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDS
|
|
|
BDBM207981 |
---|
n/a |
---|
Name | BDBM207981 |
Synonyms: | N-methyl-5-(4-chlorobenzyl)-3-(6-chloro-1-methyl-1H-indol-3-yl)-4-(4-chlorophenyl)-5-hydroxy-1,5-dihydro-2H-pyrrol-2-one (1f) |
Type | Small organic molecule |
Emp. Form. | C27H21Cl3N2O2 |
Mol. Mass. | 511.827 |
SMILES | CN1C(=O)C(=C(c2ccc(Cl)cc2)C1(O)Cc1ccc(Cl)cc1)c1cn(C)c2cc(Cl)ccc12 |t:4| |
Structure |
|