Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM230302 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Human Neutrophil Elastase Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 89±n/a nM |
---|
Comments | extracted |
---|
Citation | Oost, T; Fiegen, D; Gnamm, C; Handschuh, S; Peters, S; Roth, GJ Substituted 4-pyridones and their use as inhibitors of neutrophil elastase activity US Patent US9340507 Publication Date 5/17/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM230302 |
---|
n/a |
---|
Name | BDBM230302 |
Synonyms: | US9340507, 3.6 |
Type | Small organic molecule |
Emp. Form. | C25H25F3N2O4S |
Mol. Mass. | 506.537 |
SMILES | CC(C)n1cc(C(=O)NCc2cccc(c2)S(C)(=O)=O)c(=O)c(c1C)-c1cccc(c1)C(F)(F)F |
Structure |
|