| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Programmed cell death protein 1 |
|---|
| Ligand | BDBM482571 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme-Linked Immunosorbent Assay ELISA |
|---|
| IC50 | <5±n/a nM |
|---|
| Citation |  Lange, C; Malathong, V; Mali, VR; McMahon, J; McMurtrie, DJ; Punna, S; Roth, HS; Singh, R; Wang, Y; Yang, J; Zhang, P Immunomodulator compounds US Patent US10919852 Publication Date 2/16/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Programmed cell death protein 1 |
|---|
| Name: | Programmed cell death protein 1 |
|---|
| Synonyms: | CD_antigen=CD279 | PD1 | PDCD1 | PDCD1_HUMAN | Programmed cell death protein 1 | Protein PD-1 | hPD-1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31650.07 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_108437 |
|---|
| Residue: | 288 |
|---|
| Sequence: | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
|
|
|
|---|
| BDBM482571 |
|---|
| n/a |
|---|
| Name | BDBM482571 |
|---|
| Synonyms: | US10919852, Compound TABLE 1.270 | US11708326, Compound TABLE 1.270 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H41Cl2N5O4 |
|---|
| Mol. Mass. | 726.691 |
|---|
| SMILES | Clc1cc(CNC[C@@H]2CCC(=O)N2)c(OCc2cncc(c2)C#N)cc1O[C@H]1CCc2c1cccc2-c1cccc(OCCCN2CCC2)c1Cl |r| |
|---|
| Structure | 
|
|---|
Search and Browse
