| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Ligand | BDBM532983 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | LMPTP Primary Screening Protocol |
|---|
| IC50 | 500±n/a nM |
|---|
| Citation |  Bottini, N; Zou, J; Ganji, SR; Stanford, S; Pinkerton, A; Chung, TD; Hedrick, M; Ardecky, R Inhibitors of low molecular weight protein tyrosine phosphatase and uses thereof US Patent US11220486 Publication Date 1/11/2022 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Name: | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Synonyms: | 3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | PPAC_HUMAN | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 18042.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P24666 |
|---|
| Residue: | 158 |
|---|
| Sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
|
|
|
|---|
| BDBM532983 |
|---|
| n/a |
|---|
| Name | BDBM532983 |
|---|
| Synonyms: | (3-piperidylpropyl){2-[2- (trifluoromethoxy)phenyl](4-quinolyl)}amine | US10626094, Example I166 | US11220486, Compound G2 | US11220486, Compound I166 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H26F3N3O |
|---|
| Mol. Mass. | 429.4779 |
|---|
| SMILES | FC(F)(F)Oc1ccccc1-c1cc(NCCCC2CCCNC2)c2ccccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
