| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
|---|
| Ligand | BDBM8769 |
|---|
| Substrate/Competitor | BDBM8737 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 6.5±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| IC50 | 250±n/a nM |
|---|
| Citation |  Seefeld, MA; Miller, WH; Newlander, KA; Burgess, WJ; Payne, DJ; Rittenhouse, SF; Moore, TD; DeWolf, WE; Keller, PM; Qiu, X; Janson, CA; Vaidya, K; Fosberry, AP; Smyth, MG; Jaworski, DD; Slater-Radosti, C; Huffman, WF Inhibitors of bacterial enoyl acyl carrier protein reductase (FabI): 2,9-disubstituted 1,2,3,4-tetrahydropyrido[3,4-b]indoles as potential antibacterial agents. Bioorg Med Chem Lett11:2241-4 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
|---|
| Synonyms: | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI | FABI_STAAR | NADPH-dependent enoyl-ACP reductase | fabI | trans-2-enoyl-[acyl carrier protein] reductase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27989.00 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | Q6GI75 |
|---|
| Residue: | 256 |
|---|
| Sequence: | MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
|
|
|
|---|
| BDBM8769 |
|---|
| BDBM8737 |
|---|
| Name | BDBM8769 |
|---|
| Synonyms: | 1,2,3,4-Tetrahydropyrido[3,4-b]indole 13 | 4-({9-[(4-fluorophenyl)methyl]-1H,2H,3H,4H,9H-pyrido[3,4-b]indol-2-yl}carbonyl)phenol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H21FN2O2 |
|---|
| Mol. Mass. | 400.4448 |
|---|
| SMILES | Oc1ccc(cc1)C(=O)N1CCc2c(C1)n(Cc1ccc(F)cc1)c1ccccc21 |
|---|
| Structure | 
|
|---|
Search and Browse
