| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Androgen receptor [633-919] |
|---|
| Ligand | BDBM50529647 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Human Androgen Receptor (hAR) Ligand Binding Domain (LBD) Affinity Assay |
|---|
| Ki | 28.4±n/a nM |
|---|
| Citation |  Narayanan, R; Miller, DD; Ponnusamy, T; Hwang, D; He, Y Selective androgen receptor degrader (SARD) ligands and methods of use US Patent US11648234 Publication Date 5/16/2023 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Androgen receptor [633-919] |
|---|
| Name: | Androgen receptor [633-919] |
|---|
| Synonyms: | ANDR_HUMAN | AR | Androgen receptor (633-919) | DHTR | NR3C4 |
|---|
| Type: | aa 633-919 |
|---|
| Mol. Mass.: | 33165.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10275[633-919] |
|---|
| Residue: | 287 |
|---|
| Sequence: | KKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDN
NQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW
RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALL
LFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIAR
ELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT
|
|
|
|---|
| BDBM50529647 |
|---|
| n/a |
|---|
| Name | BDBM50529647 |
|---|
| Synonyms: | CHEMBL4584527 | US10806720, Compound 17 | US11230523, Compound 17 | US11648234, Compound 17 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H21F3N4O2 |
|---|
| Mol. Mass. | 478.4657 |
|---|
| SMILES | CN(C[C@](C)(O)C(=O)Nc1ccc(C#N)c(c1)C(F)(F)F)c1ccc(C#N)c(c1)-c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
