Reaction Details |
| Report a problem with these data |
Target | Apoptosis regulator Bcl-2 |
---|
Ligand | BDBM60828 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Biological Activity Assay |
---|
Ki | 0.180±n/a nM |
---|
Citation | Wang, Y; Liu, Z Benzenesulfonylbenazamide compound for inhibiting BCL-2 protein and composition and use thereof US Patent US11718611 Publication Date 8/8/2023 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 |
---|
Name: | Apoptosis regulator Bcl-2 |
Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
Type: | Homodimer or heterodimer |
Mol. Mass.: | 26269.11 |
Organism: | Homo sapiens (Human) |
Description: | P10415 |
Residue: | 239 |
Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
BDBM60828 |
---|
n/a |
---|
Name | BDBM60828 |
Synonyms: | ABT-199 | BDBM189459 | US10213433, Compound 5 | US10377755, Example ABT-199 | US11318134, Example ABT-199 | US11369599, Compound 369 | US11590126, Example ABT-199 | US11718611, Example T-7 | US20240043404, Example 369 | US9174982, 369 |
Type | n/a |
Emp. Form. | C45H50ClN7O7S |
Mol. Mass. | 868.439 |
SMILES | CC1(C)CCC(CN2CCN(CC2)c2ccc(C(=O)NS(=O)(=O)c3ccc(NCC4CCOCC4)c(c3)[N+]([O-])=O)c(Oc3cnc4[nH]ccc4c3)c2)=C(C1)c1ccc(Cl)cc1 |c:57| |
Structure |
|