| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP2 subtype |
|---|
| Ligand | BDBM639883 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | hEP2 cAMP Assay |
|---|
| IC50 | 2.00±n/a nM |
|---|
| Citation |  Boss, C; Corminboeuf, O; Fretz, H; Lyothier, I; Pozzi, D; Richard-Bildstein, S; Siendt, H; Sifferlen, T Pyrimidine derivatives as PGE2 receptor modulators US Patent US11839613 Publication Date 12/12/2023 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP2 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP2 subtype |
|---|
| Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39775.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43116 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
|---|
| BDBM639883 |
|---|
| n/a |
|---|
| Name | BDBM639883 |
|---|
| Synonyms: | 3-Ethoxy-5-{6-[2-(6-methoxy-benzo[b]thiophen-5-yl)-ethylamino]-pyrimidin-4-yl}- thiophene-2-carboxylic acid | US11839613, Example 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H21N3O4S2 |
|---|
| Mol. Mass. | 455.55 |
|---|
| SMILES | CCOc1cc(sc1C(O)=O)-c1cc(NCCc2cc3ccsc3cc2OC)ncn1 |
|---|
| Structure | 
|
|---|
Search and Browse
