Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide (CGRP alpha)
LigandBDBM311913
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
Ki 0.079±n/a nM
Citation Christopher JACongreve MSBucknell SJDeflorian FPickworth MMason JS CGRP receptor antagonists US Patent  US10166226 Publication Date 1/1/2019  Article
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide (CGRP alpha)
Name:Calcitonin gene-related peptide (CGRP alpha)
Synonyms:CGRP | Calcitonin gene-related peptide 1
Type:Enzyme
Mol. Mass.:13902.80
Organism:Homo sapiens (Human)
Description:P06881
Residue:128
Sequence:
MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQNYVQ
MKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFG
RRRRDLQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM311913
n/a
NameBDBM311913
Synonyms:N-[(2R)-1-[4-(4-methyl-1H-imidazol-5-yl)-1,4'-bipiperidin-1'-yl]-3-(7-methyl-1H-indazol-5-yl)-1-oxopropan-2-yl]-4-(2-oxo-1,2-dihydroquinolin-3-yl)piperidine-1-carboxamide | US10166226, Example 2
TypeSmall organic molecule
Emp. Form.C40H49N9O3
Mol. Mass.703.8756
SMILESCc1nc[nH]c1C1CCN(CC1)C1CCN(CC1)C(=O)[C@@H](Cc1cc(C)c2[nH]ncc2c1)NC(=O)N1CCC(CC1)c1cc2ccccc2[nH]c1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: