Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide (CGRP alpha)
LigandBDBM312050
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
Ki 0.063±n/a nM
Citation Christopher JACongreve MSBucknell SJDeflorian FPickworth MMason JS CGRP receptor antagonists US Patent  US10166226 Publication Date 1/1/2019  Article
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide (CGRP alpha)
Name:Calcitonin gene-related peptide (CGRP alpha)
Synonyms:CGRP | Calcitonin gene-related peptide 1
Type:Enzyme
Mol. Mass.:13902.80
Organism:Homo sapiens (Human)
Description:P06881
Residue:128
Sequence:
MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQNYVQ
MKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFG
RRRRDLQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM312050
n/a
NameBDBM312050
Synonyms:US10166226, Example 6 | ethyl 5-{1'-[(2R)-3-(7-methyl-1H-indazol-5-yl)-2-({[4-(2-oxo-1,2-dihydroquinolin-3-yl)piperidin-1-yl]carbonyl}amino)propanoyl]-1,4'-bipiperidin-4-yl}-4H-1,2,4-triazole-3-carboxylate
TypeSmall organic molecule
Emp. Form.C41H50N10O5
Mol. Mass.762.8997
SMILESCCOC(=O)c1nnc([nH]1)C1CCN(CC1)C1CCN(CC1)C(=O)[C@@H](Cc1cc(C)c2[nH]ncc2c1)NC(=O)N1CCC(CC1)c1cc2ccccc2[nH]c1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: