Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUbiquitin carboxyl-terminal hydrolase 1
LigandBDBM324810
Substrate/Competitorn/a
Meas. Tech.Ubitquin-Rhodamine 110 Assay for USP1 Activity
IC50<0.002±n/a nM
Citation Buckmelter AJIoannidis SFollows BGustafson GWang MCaravella JAWang ZFritzen ELLin J Purinones as ubiquitin-specific protease 1 inhibitors US Patent  US10189841 Publication Date 1/29/2019
More Info.:Get all data from this article,  Assay Method
 
Ubiquitin carboxyl-terminal hydrolase 1
Name:Ubiquitin carboxyl-terminal hydrolase 1
Synonyms:Deubiquitinating enzyme 1 | USP1 | Ubiquitin carboxyl-terminal hydrolase 1/WD repeat-containing protein 48  | Ubiquitin thioesterase 1 | Ubiquitin-specific-processing protease 1 | hUBP
Type:PROTEIN
Mol. Mass.:88191.62
Organism:Homo sapiens (Human)
Description:ChEMBL_104169
Residue:785
Sequence:
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQV
VPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKK
EALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVAELPTKVEEIPHPK
EEMNGINSIEMDSMRHSEDFKEKLPKGNGKRKSDTEFGNMKKKVKLSKEHQSLEENQRQT
RSKRKATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGK
ITTNQGVKGQSKENECDPEEDLGKCESDNTTNGCGLESPGNTVTPVNVNEVKPINKGEEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYNDEEVSIRVGGNTQPSKVLNK
KNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETSDTTGTHESDRNKESSD
QTGINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLL
FYKKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM324810
n/a
NameBDBM324810
Synonyms:9-(4-(2H-1,2,3-triazol-2- | US10189841, Compound I-16
TypeSmall organic molecule
Emp. Form.C21H16FN7O2
Mol. Mass.417.3958
SMILESCOc1c(F)cccc1-c1ncc2[nH]c(=O)n(Cc3ccc(cc3)-n3nccn3)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: