Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetE2 ubiquitin-conjugating enzyme E1
LigandBDBM329899
Substrate/Competitorn/a
Meas. Tech.HTRF Assay
IC50<10±n/a nM
Citation Afroze RBharathan ITCiavarri JPFleming PEGaulin JLGirard MLangston SPSoucy FWong TYe Y Pyrazolopyrimidinyl inhibitors of ubiquitin-activating enzyme US Patent  US9663525 Publication Date 5/30/2017
More Info.:Get all data from this article,  Assay Method
 
E2 ubiquitin-conjugating enzyme E1
Name:E2 ubiquitin-conjugating enzyme E1
Synonyms:n/a
Type:n/a
Mol. Mass.:21408.98
Organism:Homo sapiens (Human)
Description:P51965
Residue:193
Sequence:
MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADIT
LDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY
HCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEH
DRMARQWTKRYAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM329899
n/a
NameBDBM329899
Synonyms:(s.e.)-((1R,2R,3S,4R)-4-(2-(4-(dimethylamino)naphthalen-1-yl)pyrazolo[1,5- | US10202389, Compound I-107 | US9663525, Compound I-107
TypeSmall organic molecule
Emp. Form.C24H28N6O5S
Mol. Mass.512.581
SMILESCN(C)c1ccc(-c2cc3nccc(N[C@@H]4C[C@H](COS(N)(=O)=O)[C@@H](O)[C@H]4O)n3n2)c2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: