Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 1 |
---|
Ligand | BDBM12418 |
---|
Substrate/Competitor | BDBM11402 |
---|
Meas. Tech. | Competitive Displacement Binding Assay |
---|
pH | 7±n/a |
---|
Temperature | 298.15±n/a K |
---|
Kd | 120±n/a nM |
---|
Citation | Jude, KM; Banerjee, AL; Haldar, MK; Manokaran, S; Roy, B; Mallik, S; Srivastava, DK; Christianson, DW Ultrahigh resolution crystal structures of human carbonic anhydrases I and II complexed with "two-prong" inhibitors reveal the molecular basis of high affinity. J Am Chem Soc128:3011-8 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Carbonic anhydrase 1 |
---|
Name: | Carbonic anhydrase 1 |
Synonyms: | CA-I | CA1 | CAB | CAH1_HUMAN | Carbonate dehydratase I | Carbonic anhydrase | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA |
Type: | Enzyme |
Mol. Mass.: | 28873.37 |
Organism: | Homo sapiens (Human) |
Description: | P00915 |
Residue: | 261 |
Sequence: | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
|
|
|
BDBM12418 |
---|
BDBM11402 |
---|
Name | BDBM12418 |
Synonyms: | BR30 | copper(2+) ion 2-[(carboxylatomethyl)({2-[(4-sulfamoylphenyl)formamido]ethyl})amino]acetate |
Type | Small organic molecule |
Emp. Form. | C13H15N3O7S |
Mol. Mass. | 357.34 |
SMILES | NS(=O)(=O)c1ccc(cc1)C(=O)NCCN(CC([O-])=O)CC([O-])=O |
Structure |
|