| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM333246 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Assay for Binding Affinity for Adenosine Receptor A1 |
|---|
| Ki | 5500±n/a nM |
|---|
| Citation |  Lee, J; Kim, S; Kim, D; Ahn, K; Lee, G; Kim, D; Hwang, H Compounds antagonizing A3 adenosine receptor, method for preparing them, and medical-use thereof US Patent US10196396 Publication Date 2/5/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36520.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30542 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
|---|
| BDBM333246 |
|---|
| n/a |
|---|
| Name | BDBM333246 |
|---|
| Synonyms: | (2S,3R,4S)-2-(8-((4-methylpiperazin-1-yl)amino)-[1,2,4]triazolo[4,3-a]pyrazin-3-yl)tetrahydrothiophene-3,4-diol | US10196396, Compound 41 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H21N7O2S |
|---|
| Mol. Mass. | 351.427 |
|---|
| SMILES | CN1CCN(CC1)Nc1nccn2c(nnc12)[C@@H]1SC[C@@H](O)[C@H]1O |
|---|
| Structure | 
|
|---|
Search and Browse
