Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [491-589,Q496K] |
---|
Ligand | BDBM12883 |
---|
Substrate/Competitor | HIV-1 Protease Substrate |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
Ki | 0.006±n/a nM |
---|
Citation | Ali, A; Reddy, GS; Cao, H; Anjum, SG; Nalam, MN; Schiffer, CA; Rana, TM Discovery of HIV-1 protease inhibitors with picomolar affinities incorporating N-aryl-oxazolidinone-5-carboxamides as novel P2 ligands. J Med Chem49:7342-56 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [491-589,Q496K] |
---|
Name: | Dimer of Gag-Pol polyprotein [491-589,Q496K] |
Synonyms: | HIV-1 Protease | HIV-1 Protease (Q7K) |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [491-589,Q496K] |
Synonyms: | HIV-1 Protease chain A | POL_HV1A2 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10807.22 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P03369[491-589,Q496K] |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [491-589,Q496K] |
Synonyms: | HIV-1 Protease chain A | POL_HV1A2 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10807.22 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P03369[491-589,Q496K] |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM12883 |
---|
HIV-1 Protease Substrate |
---|
Name: | HIV-1 Protease Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 4728.18 |
Organism: | n/a |
Description: | n/a |
Residue: | 44 |
Sequence: | Arg-Glu(EDANS)-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-Lys(DABCYL)-
Arg
|
|
|