| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [491-589,Q498K,L501I,V555I,A562V,G564S,I575V,L581M] |
|---|
| Ligand | BDBM578 |
|---|
| Substrate/Competitor | HIV-1 Protease Substrate |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| Ki | 0.9±n/a nM |
|---|
| Citation |  Ali, A; Reddy, GS; Cao, H; Anjum, SG; Nalam, MN; Schiffer, CA; Rana, TM Discovery of HIV-1 protease inhibitors with picomolar affinities incorporating N-aryl-oxazolidinone-5-carboxamides as novel P2 ligands. J Med Chem49:7342-56 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [491-589,Q498K,L501I,V555I,A562V,G564S,I575V,L581M] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [491-589,Q498K,L501I,V555I,A562V,G564S,I575V,L581M] |
|---|
| Synonyms: | HIV-1 Protease Mutant M3 (L10I, L63P, A71V, G73S, I84V, L90M) |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [491-589,Q498K,L501I,V555I,A562V,G564S,I575V,L581M] |
|---|
| Synonyms: | HIV-1 Protease Mutant M3 (Q7K,L10I, V64I, A71V, G73S, I84V, L90M) chain A | HIV-1 Protease Mutant M3 (Q7K,L10I, V64I, A71V, G73S, I84V, L90M) chain B | POL_HV1A2 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10869.31 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | O38732 mutant |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [491-589,Q498K,L501I,V555I,A562V,G564S,I575V,L581M] |
|---|
| Synonyms: | HIV-1 Protease Mutant M3 (Q7K,L10I, V64I, A71V, G73S, I84V, L90M) chain A | HIV-1 Protease Mutant M3 (Q7K,L10I, V64I, A71V, G73S, I84V, L90M) chain B | POL_HV1A2 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10869.31 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | O38732 mutant |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF
|
|
|
|---|
| BDBM578 |
|---|
| HIV-1 Protease Substrate |
|---|
| Name: | HIV-1 Protease Substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 4728.18 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 44 |
|---|
| Sequence: | Arg-Glu(EDANS)-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-Lys(DABCYL)-
Arg
|
|
|
|---|
Search and Browse
