Reaction Details |
| Report a problem with these data |
Target | E3 ubiquitin-protein ligase XIAP [241-356] |
---|
Ligand | BDBM13166 |
---|
Substrate/Competitor | Smac-based peptide |
---|
Meas. Tech. | Ligand Binding Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 295.15±n/a K |
---|
Kd | 12±n/a nM |
---|
Citation | Oost, TK; Sun, C; Armstrong, RC; Al-Assaad, AS; Betz, SF; Deckwerth, TL; Ding, H; Elmore, SW; Meadows, RP; Olejniczak, ET; Oleksijew, A; Oltersdorf, T; Rosenberg, SH; Shoemaker, AR; Tomaselli, KJ; Zou, H; Fesik, SW Discovery of potent antagonists of the antiapoptotic protein XIAP for the treatment of cancer. J Med Chem47:4417-26 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
E3 ubiquitin-protein ligase XIAP [241-356] |
---|
Name: | E3 ubiquitin-protein ligase XIAP [241-356] |
Synonyms: | API3 | BIR3 domain of X-linked inhibitor of apoptosis protein | BIRC4 | E3 ubiquitin-protein ligase (XIAP-BIR3) | E3 ubiquitin-protein ligase XIAP BIR-3 | E3 ubiquitin-protein ligase XIAP BIR3 | IAP3 | X chromosome-linked inhibitor of apoptosis BIR3 domain (XIAP BIR3) | X-linked inhibitor of apoptosis protein BIR3 domain (XIAP BIR-3) | XIAP | XIAP-BIR3 | XIAP_HUMAN | baculovirus IAP repeat 3 (BIR3) domain of XIAP |
Type: | Protein Binding Domain |
Mol. Mass.: | 13276.62 |
Organism: | Homo sapiens (Human) |
Description: | BIR3 of XIAP: RESIDUES 241-356. |
Residue: | 116 |
Sequence: | SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
|
|
|
BDBM13166 |
---|
Smac-based peptide |
---|
Name: | Smac-based peptide |
Synonyms: | 6-Carboxyfluorescein (FAM) labeled peptide AVPIAQK |
Type: | Peptide |
Mol. Mass.: | 1328.08 |
Organism: | n/a |
Description: | n/a |
Residue: | 12 |
Sequence: | |