| Reaction Details |
|---|
 | Report a problem with these data |
| Target | E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Ligand | BDBM13175 |
|---|
| Substrate/Competitor | Smac-based peptide |
|---|
| Meas. Tech. | Ligand Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Kd | 16±n/a nM |
|---|
| Citation |  Oost, TK; Sun, C; Armstrong, RC; Al-Assaad, AS; Betz, SF; Deckwerth, TL; Ding, H; Elmore, SW; Meadows, RP; Olejniczak, ET; Oleksijew, A; Oltersdorf, T; Rosenberg, SH; Shoemaker, AR; Tomaselli, KJ; Zou, H; Fesik, SW Discovery of potent antagonists of the antiapoptotic protein XIAP for the treatment of cancer. J Med Chem47:4417-26 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Name: | E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Synonyms: | API3 | BIR3 domain of X-linked inhibitor of apoptosis protein | BIRC4 | E3 ubiquitin-protein ligase (XIAP-BIR3) | E3 ubiquitin-protein ligase XIAP BIR-3 | E3 ubiquitin-protein ligase XIAP BIR3 | IAP3 | X chromosome-linked inhibitor of apoptosis BIR3 domain (XIAP BIR3) | X-linked inhibitor of apoptosis protein BIR3 domain (XIAP BIR-3) | XIAP | XIAP-BIR3 | XIAP_HUMAN | baculovirus IAP repeat 3 (BIR3) domain of XIAP |
|---|
| Type: | Protein Binding Domain |
|---|
| Mol. Mass.: | 13276.62 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | BIR3 of XIAP: RESIDUES 241-356. |
|---|
| Residue: | 116 |
|---|
| Sequence: | SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
|
|
|
|---|
| BDBM13175 |
|---|
| Smac-based peptide |
|---|
| Name: | Smac-based peptide |
|---|
| Synonyms: | 6-Carboxyfluorescein (FAM) labeled peptide AVPIAQK |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 1328.08 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 12 |
|---|
| Sequence: | |
|---|
Search and Browse
