| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM13558 |
|---|
| Substrate/Competitor | BDBM13574 |
|---|
| Meas. Tech. | Serine Protease Inhibition Assay |
|---|
| Ki | 16900±n/a nM |
|---|
| Citation |  Groebke Zbinden, K; Banner, DW; Hilpert, K; Himber, J; Lave, T; Riederer, MA; Stahl, M; Tschopp, TB; Obst-Sander, U Dose-dependent antithrombotic activity of an orally active tissue factor/factor VIIa inhibitor without concomitant enhancement of bleeding propensity. Bioorg Med Chem14:5357-69 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM13558 |
|---|
| BDBM13574 |
|---|
| Name | BDBM13558 |
|---|
| Synonyms: | 2-[(4-carbamimidoylphenyl)amino]-2-(3,5-diethoxyphenyl)acetic acid | phenylglycine deriv. 6 | phenylglycine derivative 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H23N3O4 |
|---|
| Mol. Mass. | 357.4036 |
|---|
| SMILES | CCOc1cc(OCC)cc(c1)C(Nc1ccc(cc1)C(N)=N)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
