Reaction Details |
| Report a problem with these data |
Target | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
---|
Ligand | BDBM13975 |
---|
Substrate/Competitor | BDBM13466 |
---|
Meas. Tech. | PTP1B and TCPTP Inhibition Assay |
---|
Ki | 170±n/a nM |
---|
Citation | Liu, G; Szczepankiewicz, BG; Pei, Z; Janowick, DA; Xin, Z; Hajduk, PJ; Abad-Zapatero, C; Liang, H; Hutchins, CW; Fesik, SW; Ballaron, SJ; Stashko, MA; Lubben, T; Mika, AK; Zinker, BA; Trevillyan, JM; Jirousek, MR Discovery and structure-activity relationship of oxalylarylaminobenzoic acids as inhibitors of protein tyrosine phosphatase 1B. J Med Chem46:2093-103 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
---|
Name: | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
Synonyms: | PTN1_HUMAN | PTP-1B | PTP1B | PTPN1 | PTPase 1B | Protein-Tyrosine Phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase, non-receptor type 1 |
Type: | Enzyme |
Mol. Mass.: | 34670.65 |
Organism: | Homo sapiens (Human) |
Description: | The catalytic domain of PTP 1B (residues 1-298) was expressed and purified from E. coli. |
Residue: | 298 |
Sequence: | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED
|
|
|
BDBM13975 |
---|
BDBM13466 |
---|
Name | BDBM13975 |
Synonyms: | 2-({2-[(1E)-2-carbamoyleth-1-en-1-yl]-4-[(2S)-2-methanesulfonamido-2-(pentylcarbamoyl)ethyl]phenyl}amidoformic acid)benzoic acid | 2-{[2-(2-Carbamoylvinyl)-4-(2-(S)-methanesulfonylamino 2-pentylcarbamoylethyl)phenyl]oxalylamino}-benzoic Acid | Oxalylarylaminobenzoic Acid Analog 17 |
Type | Small organic molecule |
Emp. Form. | C27H32N4O9S |
Mol. Mass. | 588.629 |
SMILES | CCCCCNC(=O)[C@H](Cc1ccc(N(C(=O)C(O)=O)c2ccccc2C(O)=O)c(\C=C\C(N)=O)c1)NS(C)(=O)=O |r| |
Structure |
|