| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proto-oncogene tyrosine-protein kinase Src [145-252] |
|---|
| Ligand | BDBM14696 |
|---|
| Substrate/Competitor | Peptide Substrate |
|---|
| Meas. Tech. | Scintillation Proximity Assay (SPA) |
|---|
| IC50 | 120±n/a nM |
|---|
| Citation |  Lange, G; Lesuisse, D; Deprez, P; Schoot, B; Loenze, P; Benard, D; Marquette, JP; Broto, P; Sarubbi, E; Mandine, E Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors. J Med Chem46:5184-95 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Proto-oncogene tyrosine-protein kinase Src [145-252] |
|---|
| Name: | Proto-oncogene tyrosine-protein kinase Src [145-252] |
|---|
| Synonyms: | Proto-oncogene tyrosine-protein kinase Src | Proto-oncogene tyrosine-protein kinase Src (aa 145-252) | SRC | SRC1 | SRC_HUMAN | c-Src pp60c-src | p60-Src |
|---|
| Type: | SH2 Domain |
|---|
| Mol. Mass.: | 12362.36 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Src-SH2 proteins (amino acid residues 145-252) were chemically biotinylated using a 10-fold molar excess of D-biotin-N-hydroxy-succinimidester and purified by gel filtration yielding conjugates with an average ratio of two biotin moieties per protein molecule. |
|---|
| Residue: | 108 |
|---|
| Sequence: | SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKH
YKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSK
|
|
|
|---|
| BDBM14696 |
|---|
| Peptide Substrate |
|---|
| Name: | Peptide Substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 1600.79 |
|---|
| Organism: | n/a |
|---|
| Description: | Peptide EPQpYEEIPIYL (middle-T antigen) was monoiodinated on tyrosine. |
|---|
| Residue: | 13 |
|---|
| Sequence: | |
|---|
Search and Browse
