Reaction Details |
| Report a problem with these data |
Target | Proto-oncogene tyrosine-protein kinase Src [145-252] |
---|
Ligand | BDBM14698 |
---|
Substrate/Competitor | Peptide Substrate |
---|
Meas. Tech. | Scintillation Proximity Assay (SPA) |
---|
IC50 | 2200±n/a nM |
---|
Citation | Lange, G; Lesuisse, D; Deprez, P; Schoot, B; Loenze, P; Benard, D; Marquette, JP; Broto, P; Sarubbi, E; Mandine, E Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors. J Med Chem46:5184-95 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Proto-oncogene tyrosine-protein kinase Src [145-252] |
---|
Name: | Proto-oncogene tyrosine-protein kinase Src [145-252] |
Synonyms: | Proto-oncogene tyrosine-protein kinase Src | Proto-oncogene tyrosine-protein kinase Src (aa 145-252) | SRC | SRC1 | SRC_HUMAN | c-Src pp60c-src | p60-Src |
Type: | SH2 Domain |
Mol. Mass.: | 12362.36 |
Organism: | Homo sapiens (Human) |
Description: | Src-SH2 proteins (amino acid residues 145-252) were chemically biotinylated using a 10-fold molar excess of D-biotin-N-hydroxy-succinimidester and purified by gel filtration yielding conjugates with an average ratio of two biotin moieties per protein molecule. |
Residue: | 108 |
Sequence: | SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKH
YKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSK
|
|
|
BDBM14698 |
---|
Peptide Substrate |
---|
Name: | Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 1600.79 |
Organism: | n/a |
Description: | Peptide EPQpYEEIPIYL (middle-T antigen) was monoiodinated on tyrosine. |
Residue: | 13 |
Sequence: | |