| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 14 |
|---|
| Ligand | BDBM14831 |
|---|
| Substrate/Competitor | BDBM14832 |
|---|
| Meas. Tech. | Fluorescence Exchange Curve Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 296.15±n/a K |
|---|
| Kd | 1160±n/a nM |
|---|
| Comments | Kd was determined and calculated as koff/kon. |
|---|
| Citation |  Pargellis, C; Tong, L; Churchill, L; Cirillo, PF; Gilmore, T; Graham, AG; Grob, PM; Hickey, ER; Moss, N; Pav, S; Regan, J Inhibition of p38 MAP kinase by utilizing a novel allosteric binding site. Nat Struct Biol9:268-72 (2002) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 14 |
|---|
| Name: | Mitogen-activated protein kinase 14 |
|---|
| Synonyms: | CSAID-binding protein | CSBP | CSBP1 | CSBP2 | CSPB1 | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAPK14 | MAX-interacting protein 2 | MK14_HUMAN | MXI2 | Mitogen-activated protein kinase p38 alpha | SAPK2A | Stress-activated protein kinase 2a | p38 MAP kinase alpha/beta |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 41286.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q16539 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
|---|
| BDBM14831 |
|---|
| BDBM14832 |
|---|
| Name | BDBM14831 |
|---|
| Synonyms: | 3-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-1-(4-chlorophenyl)urea | 3-(4-chlorophenyl)-1-(2-methyl-5-tert-butyl-pyrazol-3-yl)urea | CHEMBL87277 | Dopamine D2 receptor and serotonin 2a receptor | diaryl urea compound 2 | diaryl urea inhibitor 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H19ClN4O |
|---|
| Mol. Mass. | 306.791 |
|---|
| SMILES | Cn1nc(cc1NC(=O)Nc1ccc(Cl)cc1)C(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
