| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Ligand | BDBM15693 |
|---|
| Substrate/Competitor | BDBM15648 |
|---|
| Meas. Tech. | Enoyl-CoA Reductase Inhibition Assay |
|---|
| IC50 | 6410±n/a nM |
|---|
| Citation |  He, X; Alian, A; Stroud, R; Ortiz de Montellano, PR Pyrrolidine carboxamides as a novel class of inhibitors of enoyl acyl carrier protein reductase from Mycobacterium tuberculosis. J Med Chem49:6308-23 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Synonyms: | Enoyl-ACP Reductase (InhA) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-[acyl-carrier-protein] reductase [NADH] | INHA_MYCTU | NADH-dependent enoyl-ACP reductase | inhA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28526.00 |
|---|
| Organism: | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
|---|
| Description: | P9WGR1 |
|---|
| Residue: | 269 |
|---|
| Sequence: | MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI
HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK
TVCALLSDWLPATTGDIIYADGGAHTQLL
|
|
|
|---|
| BDBM15693 |
|---|
| BDBM15648 |
|---|
| Name | BDBM15693 |
|---|
| Synonyms: | 1-Cyclohexyl-4-(1-((4-fluorophenyl)(phenyl)methyl)piperazine-4-carbonyl)pyrrolidin-2-one | 1-cyclohexyl-4-({4-[(4-fluorophenyl)(phenyl)methyl]piperazin-1-yl}carbonyl)pyrrolidin-2-one | Pyrrolidine Carboxamide Compound p28 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H34FN3O2 |
|---|
| Mol. Mass. | 463.5869 |
|---|
| SMILES | Fc1ccc(cc1)C(N1CCN(CC1)C(=O)C1CN(C2CCCCC2)C(=O)C1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
