| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 2 |
|---|
| Ligand | BDBM15817 |
|---|
| Substrate/Competitor | BDBM13466 |
|---|
| Meas. Tech. | PTP1B and TCPTP Inhibition Assay |
|---|
| Ki | 240±n/a nM |
|---|
| Citation |  Xin, Z; Oost, TK; Abad-Zapatero, C; Hajduk, PJ; Pei, Z; Szczepankiewicz, BG; Hutchins, CW; Ballaron, SJ; Stashko, MA; Lubben, T; Trevillyan, JM; Jirousek, MR; Liu, G Potent, selective inhibitors of protein tyrosine phosphatase 1B. Bioorg Med Chem Lett13:1887-90 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 2 |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 2 |
|---|
| Synonyms: | PTN2_HUMAN | PTPN2 | PTPT | T-cell protein tyrosine phosphatase (TCPTP) | T-cell protein-tyrosine phosphatase | TC-PTP | TCPTP | Tyrosine-protein phosphatase non-receptor type 2 | Tyrosine-protein phosphatase non-receptor type 2 (TC-PTP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 48481.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P17706 |
|---|
| Residue: | 415 |
|---|
| Sequence: | MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
|
|
|
|---|
| BDBM15817 |
|---|
| BDBM13466 |
|---|
| Name | BDBM15817 |
|---|
| Synonyms: | 1:1 mixture of diastereomers | 2-[(4-{2-[(4-{[(1S)-1-carboxypentyl]carbamoyl}butyl)carbamoyl]-2-acetamidoethyl}-2-ethylphenyl)amidoformic acid]benzoic acid | oxalyl-aryl-amino benzoic acid-based inhibitor 17 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H42N4O10 |
|---|
| Mol. Mass. | 654.7074 |
|---|
| SMILES | CCCC[C@H](NC(=O)CCCCNC(=O)C(Cc1ccc(N(C(=O)C(O)=O)c2ccccc2C(O)=O)c(CC)c1)NC(C)=O)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
