Reaction Details |
| Report a problem with these data |
Target | ATP-sensitive inward rectifier potassium channel 1 |
---|
Ligand | BDBM350299 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Thallium Flux Assay |
---|
IC50 | 7.00±n/a nM |
---|
Citation | Pasternak, A; Davies, I; Ding, F; Jiang, J; Dong, S; Gu, X; Suzuki, T; Vacca, JP; Pu, Z; Xu, S Inhibitors of the renal outer medullary potassium channel US Patent US10208064 Publication Date 2/19/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
ATP-sensitive inward rectifier potassium channel 1 |
---|
Name: | ATP-sensitive inward rectifier potassium channel 1 |
Synonyms: | ATP-regulated potassium channel ROM-K | ATP-regulated potassium channel ROMK | ATP-sensitive inward rectifier potassium channel 1 | Egl nine homolog 1 | KCNJ1 | KCNJ1_HUMAN | Potassium channel (ATP modulatory) | Potassium inwardly-rectifying channel, subfamily J, member 1 | ROMK1 | Renal Outer Medullary Potassium (ROMK1) | The Renal Outer Medullary Potassium (ROMK) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 44809.08 |
Organism: | Homo sapiens (Human) |
Description: | gi_223460826 |
Residue: | 391 |
Sequence: | MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
|
|
|
BDBM350299 |
---|
n/a |
---|
Name | BDBM350299 |
Synonyms: | US10208064, Example 18 |
Type | Small organic molecule |
Emp. Form. | C24H26N6O4 |
Mol. Mass. | 462.501 |
SMILES | C[C@@H]1CC2(CCN(C[C@@H](O)c3ccc4c(ccc5nnnn45)c3)CC2)C(=O)N1C1=CC(=O)OC1 |r,t:33| |
Structure |
|