Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrokinase-type plasminogen activator
LigandBDBM16154
Substrate/CompetitorBDBM14716
Meas. Tech.Determination of Inhibitor Potency and Selectivity
Ki 5.8±n/a nM
Citation Fish PVBarber CGBrown DGButt RCollis MGDickinson RPHenry BTHorne VAHuggins JPKing EO'gara MMcCleverty DMcIntosh FPhillips CWebster R Selective Urokinase-Type Plasminogen Activator Inhibitors. 4. 1-(7-Sulfonamidoisoquinolinyl)guanidines. J Med Chem 50:2341-51 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Urokinase-type plasminogen activator
Name:Urokinase-type plasminogen activator/surface receptor
Synonyms:U-plasminogen activator | Urokinase | Urokinase-type plasminogen activator (uPA)
Type:Enzyme
Mol. Mass.:48528.62
Organism:Homo sapiens (Human)
Description:P00749
Residue:431
Sequence:
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16154
BDBM14716
NameBDBM16154
Synonyms:1-({4-chloro-1-[(diaminomethylidene)amino]isoquinoline-7-}sulfonamido)cyclopentane-1-carboxylic acid | substituted glycine deriv. 28
TypeSmall organic molecule
Emp. Form.C16H18ClN5O4S
Mol. Mass.411.863
SMILES[#7]\[#6](-[#7])=[#7]/c1ncc(Cl)c2ccc(cc12)S(=O)(=O)[#7]C1([#6]-[#6]-[#6]-[#6]1)[#6](-[#8])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: